Lineage for d1hqga_ (1hqg A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2115321Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2115322Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2115323Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 protein domains)
    Pfam PF00491
  6. 2115344Protein Arginase [52770] (5 species)
  7. 2115451Species Norway rat (Rattus norvegicus) [TaxId:10116] [52771] (34 PDB entries)
    Uniprot P07824
  8. 2115465Domain d1hqga_: 1hqg A: [61136]
    complexed with mn, orn, ure

Details for d1hqga_

PDB Entry: 1hqg (more details), 2 Å

PDB Description: crystal structure of the h141c arginase variant complexed with products ornithine and urea
PDB Compounds: (A:) arginase 1

SCOPe Domain Sequences for d1hqga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hqga_ c.42.1.1 (A:) Arginase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kpieiigapfskgqprggvekgpaalrkaglveklketeynvrdhgdlafvdvpndspfq
ivknprsvgkaneqlaavvaetqkngtisvvlggdhsmaigsisgharvhpdlcviwvda
htdintplttssgnlcgqpvafllkelkgkfpdvpgfswvtpcisakdivyiglrdvdpg
ehyiiktlgikyfsmtevdklgigkvmeetfsyllgrkkrpihlsfdvdgldpvftpatg
tpvvgglsyreglyiteeiyktgllsgldimevnptlgktpeevtrtvntavaltlscfg
tkregnhkpetdyl

SCOPe Domain Coordinates for d1hqga_:

Click to download the PDB-style file with coordinates for d1hqga_.
(The format of our PDB-style files is described here.)

Timeline for d1hqga_: