SCOPe 2.07: Domain d1hqba_: 1hqb A:

Lineage for d1hqba_ (1hqb A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.3: apo-D-alanyl carrier protein [63535] (1 protein)
   automatically mapped to Pfam PF00550

6. Protein apo-D-alanyl carrier protein [63536] (2 species)

7. Species Lactobacillus casei [TaxId:1582] [63537] (2 PDB entries)

8. Domain d1hqba_: 1hqb A: [61128]

Details for d1hqba_

PDB Entry: 1hqb

PDB Description: tertiary structure of apo-d-alanyl carrier protein

PDB Compounds: (A:) apo-d-alanyl carrier protein

SCOPe Domain Sequences for d1hqba_:

Sequence; same for both SEQRES and ATOM records:

>d1hqba_ a.28.1.3 (A:) apo-D-alanyl carrier protein {Lactobacillus casei [TaxId: 1582]}
adeaikngvldiladltgsddvkknldlnlfetglldsmgtvqlllelqsqfgvdapvse
fdrkewdtpnkiiakveqaq

Timeline for d1hqba_:

• d1hqba_ first appeared in SCOP 1.57
  
• d1hqba_ appears in SCOPe 2.06
  
• d1hqba_ appears in the current release, SCOPe 2.08