Lineage for d1hqba_ (1hqb A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 212717Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 212718Superfamily a.28.1: ACP-like [47336] (3 families) (S)
  5. 212740Family a.28.1.3: apo-D-alanyl carrier protein [63535] (1 protein)
  6. 212741Protein apo-D-alanyl carrier protein [63536] (1 species)
  7. 212742Species Lactobacillus casei [TaxId:1582] [63537] (2 PDB entries)
  8. 212744Domain d1hqba_: 1hqb A: [61128]

Details for d1hqba_

PDB Entry: 1hqb (more details)

PDB Description: tertiary structure of apo-d-alanyl carrier protein

SCOP Domain Sequences for d1hqba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hqba_ a.28.1.3 (A:) apo-D-alanyl carrier protein {Lactobacillus casei}
adeaikngvldiladltgsddvkknldlnlfetglldsmgtvqlllelqsqfgvdapvse
fdrkewdtpnkiiakveqaq

SCOP Domain Coordinates for d1hqba_:

Click to download the PDB-style file with coordinates for d1hqba_.
(The format of our PDB-style files is described here.)

Timeline for d1hqba_: