Lineage for d1hp7a_ (1hp7 A:)

  1. Root: SCOP 1.67
  2. 423625Class e: Multi-domain proteins (alpha and beta) [56572] (40 folds)
  3. 423626Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 423627Superfamily e.1.1: Serpins [56574] (1 family) (S)
  5. 423628Family e.1.1.1: Serpins [56575] (15 proteins)
  6. 423672Protein Antitrypsin, alpha-1 [56582] (1 species)
  7. 423673Species Human (Homo sapiens) [TaxId:9606] [56583] (14 PDB entries)
  8. 423676Domain d1hp7a_: 1hp7 A: [61117]
    intact chain
    complexed with seo, zn; mutant

Details for d1hp7a_

PDB Entry: 1hp7 (more details), 2.1 Å

PDB Description: a 2.1 angstrom structure of an uncleaved alpha-1-antitrypsin shows variability of the reactive center and other loops

SCOP Domain Sequences for d1hp7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hp7a_ e.1.1.1 (A:) Antitrypsin, alpha-1 {Human (Homo sapiens)}
dhptfnkitpnlaefafslyrqlahqsnstniffspvsiatafamlslgtkgdthdeile
glnfnlteipeaqihegfqellhtlnqpdsqlqlttgnglflseglklvdkfledvkkly
hseaftvnfgdteeakkqindyvekgtqgkivdlvkeldrdtvfalvnyiffkgkwerpf
evkdteeedfhvdqvttvkvpmmkrlgmfniqhckklsswvllmkylgnataifflpdeg
klqhlenelthdiitkflenedrrsaslhlpklsitgtydlksvlgqlgitkvfsngadl
sgvteeaplklskavhkavltidekgteaagamfleaipmsippevkfnkpfvflmidqn
tksplfmgkvvnptqk

SCOP Domain Coordinates for d1hp7a_:

Click to download the PDB-style file with coordinates for d1hp7a_.
(The format of our PDB-style files is described here.)

Timeline for d1hp7a_: