Lineage for d1hp2a_ (1hp2 A:)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 142669Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 142888Superfamily g.3.7: Scorpion toxin-like [57095] (5 families) (S)
  5. 142941Family g.3.7.2: Short-chain scorpion toxins [57116] (22 proteins)
  6. 142945Protein alpha-KTX, K+-channel blocker [64537] (2 species)
  7. 142946Species Brazilian scorpion (Tityus serrulatus), Tstx-k alpha [TaxId:6887] [64538] (1 PDB entry)
  8. 142947Domain d1hp2a_: 1hp2 A: [61110]

Details for d1hp2a_

PDB Entry: 1hp2 (more details)

PDB Description: solution structure of a toxin from the scorpion tityus serrulatus (tstx-k alpha) determined by nmr.

SCOP Domain Sequences for d1hp2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hp2a_ g.3.7.2 (A:) alpha-KTX, K+-channel blocker {Brazilian scorpion (Tityus serrulatus), Tstx-k alpha}
vfinakcrgspeclpkckeaigkaagkcmngkckcyp

SCOP Domain Coordinates for d1hp2a_:

Click to download the PDB-style file with coordinates for d1hp2a_.
(The format of our PDB-style files is described here.)

Timeline for d1hp2a_: