| Class b: All beta proteins [48724] (144 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.5: p53-like transcription factors [49417] (7 families) ![]() |
| Family b.2.5.6: RUNT domain [81318] (1 protein) |
| Protein Acute myeloid leukemia 1 protein (AML1), RUNT domain [49439] (2 species) synonym: core binding factor alpha, cbfa |
| Species Mouse (Mus musculus) [TaxId:10090] [63684] (6 PDB entries) almost identical sequence to the human protein |
| Domain d1hjcd_: 1hjc D: [61080] |
PDB Entry: 1hjc (more details), 2.65 Å
SCOP Domain Sequences for d1hjcd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hjcd_ b.2.5.6 (D:) Acute myeloid leukemia 1 protein (AML1), RUNT domain {Mouse (Mus musculus)}
gelvrtdspnflcsvlpthwrcnktlpiafkvvalgdvpdgtlvtvmagndenysaelrn
ataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitvdgprepr
Timeline for d1hjcd_: