Lineage for d1hjca_ (1hjc A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 456653Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 456866Superfamily b.2.5: p53-like transcription factors [49417] (7 families) (S)
  5. 456974Family b.2.5.6: RUNT domain [81318] (1 protein)
  6. 456975Protein Acute myeloid leukemia 1 protein (AML1), RUNT domain [49439] (2 species)
    synonym: core binding factor alpha, cbfa
  7. 456989Species Mouse (Mus musculus) [TaxId:10090] [63684] (6 PDB entries)
    almost identical sequence to the human protein
  8. 456995Domain d1hjca_: 1hjc A: [61079]

Details for d1hjca_

PDB Entry: 1hjc (more details), 2.65 Å

PDB Description: crystal structure of runx-1/aml1/cbfalpha runt domain bound to a dna fragment from the csf-1r promoter

SCOP Domain Sequences for d1hjca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hjca_ b.2.5.6 (A:) Acute myeloid leukemia 1 protein (AML1), RUNT domain {Mouse (Mus musculus)}
gelvrtdspnflcsvlpthwrcnktlpiafkvvalgdvpdgtlvtvmagndenysaelrn
ataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitvdgprepr

SCOP Domain Coordinates for d1hjca_:

Click to download the PDB-style file with coordinates for d1hjca_.
(The format of our PDB-style files is described here.)

Timeline for d1hjca_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1hjcd_