SCOP 1.61: Domain d1hjbd_: 1hjb D:

Lineage for d1hjbd_ (1hjb D:)

1. Root: SCOP 1.61

2. Class h: Coiled coil proteins [57942] (5 folds)

3. Fold h.1: Parallel coiled-coil [57943] (22 superfamilies)

4. Superfamily h.1.3: Leucine zipper domain [57959] (1 family)

5. Family h.1.3.1: Leucine zipper domain [57960] (13 proteins)

6. Protein C/ebp beta [57985] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64590] (5 PDB entries)

8. Domain d1hjbd_: 1hjb D: [61076]
   Other proteins in same PDB: d1hjbc_, d1hjbf_

Details for d1hjbd_

PDB Entry: 1hjb, 3 Å

PDB Description: crystal structure of runx-1/aml1/cbfalpha runt domain and c/ebpbeta bzip homodimer bound to a dna fragment from the csf-1r promoter

SCOP Domain Sequences for d1hjbd_:

Sequence; same for both SEQRES and ATOM records:

>d1hjbd_ h.1.3.1 (D:) C/ebp beta {Human (Homo sapiens)}
dkhsdeykirrernniavrksrdkakmrnletqhkvleltaenerlqkkveqlsrelstl
rnlfkqlp

Timeline for d1hjbd_:

• d1hjbd_ first appeared in SCOP 1.57
  
• d1hjbd_ appears in SCOP 1.59
  
• d1hjbd_ appears in SCOP 1.63
  
• d1hjbd_ appears in the current release, SCOPe 2.08