Lineage for d1hjbc_ (1hjb C:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1525229Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1525684Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 1526006Family b.2.5.6: RUNT domain [81318] (2 proteins)
    automatically mapped to Pfam PF00853
  6. 1526007Protein Acute myeloid leukemia 1 protein (AML1), RUNT domain [49439] (2 species)
    synonym: core binding factor alpha, cbfa
  7. 1526021Species Mouse (Mus musculus) [TaxId:10090] [63684] (7 PDB entries)
    almost identical sequence to the human protein
  8. 1526030Domain d1hjbc_: 1hjb C: [61075]
    Other proteins in same PDB: d1hjba_, d1hjbb_, d1hjbd_, d1hjbe_
    protein/DNA complex

Details for d1hjbc_

PDB Entry: 1hjb (more details), 3 Å

PDB Description: crystal structure of runx-1/aml1/cbfalpha runt domain and c/ebpbeta bzip homodimer bound to a dna fragment from the csf-1r promoter
PDB Compounds: (C:) runt-related transcription factor 1

SCOPe Domain Sequences for d1hjbc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hjbc_ b.2.5.6 (C:) Acute myeloid leukemia 1 protein (AML1), RUNT domain {Mouse (Mus musculus) [TaxId: 10090]}
gelvrtdspnflcsvlpthwrcnktlpiafkvvalgdvpdgtlvtvmagndenysaelrn
ataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitvdgpreprrh

SCOPe Domain Coordinates for d1hjbc_:

Click to download the PDB-style file with coordinates for d1hjbc_.
(The format of our PDB-style files is described here.)

Timeline for d1hjbc_: