SCOP 1.71: Domain d1hjba_: 1hjb A:

Lineage for d1hjba_ (1hjb A:)

1. Root: SCOP 1.71

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (29 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.3: Leucine zipper domain [57959] (1 family)

5. Family h.1.3.1: Leucine zipper domain [57960] (15 proteins)

6. Protein C/ebp beta [57985] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64590] (8 PDB entries)

8. Domain d1hjba_: 1hjb A: [61073]
   Other proteins in same PDB: d1hjbc_, d1hjbf_

Details for d1hjba_

PDB Entry: 1hjb, 3 Å

PDB Description: crystal structure of runx-1/aml1/cbfalpha runt domain and c/ebpbeta bzip homodimer bound to a dna fragment from the csf-1r promoter

SCOP Domain Sequences for d1hjba_:

Sequence; same for both SEQRES and ATOM records:

>d1hjba_ h.1.3.1 (A:) C/ebp beta {Human (Homo sapiens)}
dkhsdeykirrernniavrksrdkakmrnletqhkvleltaenerlqkkveqlsrelstl
rnlfkq

Timeline for d1hjba_:

• d1hjba_ first appeared in SCOP 1.57
  
• d1hjba_ appears in SCOP 1.69
  
• d1hjba_ appears in SCOP 1.73
  
• d1hjba_ appears in the current release, SCOPe 2.08