Lineage for d1hh1a_ (1hh1 A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 316351Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 316352Superfamily c.52.1: Restriction endonuclease-like [52980] (20 families) (S)
  5. 316535Family c.52.1.18: Archaeal Holliday junction resolvase Hjc [64080] (1 protein)
  6. 316536Protein Archaeal Holliday junction resolvase Hjc [64081] (2 species)
  7. 316544Species Archaeon Sulfolobus solfataricus [TaxId:2287] [64083] (1 PDB entry)
  8. 316545Domain d1hh1a_: 1hh1 A: [61036]

Details for d1hh1a_

PDB Entry: 1hh1 (more details), 2.15 Å

PDB Description: the structure of hjc, a holliday junction resolving enzyme from sulfolobus solfataricus

SCOP Domain Sequences for d1hh1a_:

Sequence, based on SEQRES records: (download)

>d1hh1a_ c.52.1.18 (A:) Archaeal Holliday junction resolvase Hjc {Archaeon Sulfolobus solfataricus}
savernivsrlrdkgfavvrapasgskrkdpipdiialkngviiliemksrkdiegkiyv
rreqaegiiefarksggslflgvkkpgvlkfipfeklrrtetgnyvadseiegldledlv
rlveakisrtld

Sequence, based on observed residues (ATOM records): (download)

>d1hh1a_ c.52.1.18 (A:) Archaeal Holliday junction resolvase Hjc {Archaeon Sulfolobus solfataricus}
savernivsrlrdkgfavvrapapipdiialkngviiliemksrkdiegkiyvrreqaeg
iiefarksggslflgvkkpgvlkfipfeklrrtetgnyvadseiegldledlvrlveaki
srtld

SCOP Domain Coordinates for d1hh1a_:

Click to download the PDB-style file with coordinates for d1hh1a_.
(The format of our PDB-style files is described here.)

Timeline for d1hh1a_: