SCOP 1.57: Domain d1hh1a_: 1hh1 A:

Lineage for d1hh1a_ (1hh1 A:)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (18 families)

5. Family c.52.1.18: Archaeal Holliday junction resolvase Hjc [64080] (1 protein)

6. Protein Archaeal Holliday junction resolvase Hjc [64081] (2 species)

7. Species Archaeon Sulfolobus solfataricus [TaxId:2287] [64083] (1 PDB entry)

8. Domain d1hh1a_: 1hh1 A: [61036]

Details for d1hh1a_

PDB Entry: 1hh1, 2.15 Å

PDB Description: the structure of hjc, a holliday junction resolving enzyme from sulfolobus solfataricus

SCOP Domain Sequences for d1hh1a_:

Sequence, based on SEQRES records:

>d1hh1a_ c.52.1.18 (A:) Archaeal Holliday junction resolvase Hjc {Archaeon Sulfolobus solfataricus}
savernivsrlrdkgfavvrapasgskrkdpipdiialkngviiliemksrkdiegkiyv
rreqaegiiefarksggslflgvkkpgvlkfipfeklrrtetgnyvadseiegldledlv
rlveakisrtld

Sequence, based on observed residues (ATOM records):

>d1hh1a_ c.52.1.18 (A:) Archaeal Holliday junction resolvase Hjc {Archaeon Sulfolobus solfataricus}
savernivsrlrdkgfavvrapapipdiialkngviiliemksrkdiegkiyvrreqaeg
iiefarksggslflgvkkpgvlkfipfeklrrtetgnyvadseiegldledlvrlveaki
srtld

Timeline for d1hh1a_:

• d1hh1a_ is new in SCOP 1.57
  
• d1hh1a_ appears in SCOP 1.59
  
• d1hh1a_ appears in the current release, SCOPe 2.08