Lineage for d1hfod_ (1hfo D:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 606391Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 606392Superfamily d.80.1: Tautomerase/MIF [55331] (5 families) (S)
  5. 606477Family d.80.1.3: MIF-related [55339] (2 proteins)
  6. 606483Protein Microphage migration inhibition factor (MIF) [55340] (5 species)
    synonym: glycosylation-inhibiting factor (GIF)
  7. 606523Species Trichina (Trichinella spiralis) [64323] (1 PDB entry)
  8. 606527Domain d1hfod_: 1hfo D: [61009]

Details for d1hfod_

PDB Entry: 1hfo (more details), 1.65 Å

PDB Description: the structure of the macrophage migration inhibitory factor from trichinella spiralis.

SCOP Domain Sequences for d1hfod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hfod_ d.80.1.3 (D:) Microphage migration inhibition factor (MIF) {Trichina (Trichinella spiralis)}
piftlntnikatdvpsdflsstsalvgnilskpgsyvavhintdqqlsfggstnpaafgt
lmsiggiepsrnrdhsaklfdhlntklgipknrmyihfvnlngddvgwngttf

SCOP Domain Coordinates for d1hfod_:

Click to download the PDB-style file with coordinates for d1hfod_.
(The format of our PDB-style files is described here.)

Timeline for d1hfod_: