![]() | Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
![]() | Fold d.80: Tautomerase/MIF [55330] (1 superfamily) |
![]() | Superfamily d.80.1: Tautomerase/MIF [55331] (3 families) ![]() |
![]() | Family d.80.1.3: MIF-related [55339] (2 proteins) |
![]() | Protein Microphage migration inhibition factor (MIF) [55340] (4 species) |
![]() | Species Trichina (Trichinella spiralis) [64323] (1 PDB entry) |
![]() | Domain d1hfod_: 1hfo D: [61009] |
PDB Entry: 1hfo (more details), 1.65 Å
SCOP Domain Sequences for d1hfod_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hfod_ d.80.1.3 (D:) Microphage migration inhibition factor (MIF) {Trichina (Trichinella spiralis)} piftlntnikatdvpsdflsstsalvgnilskpgsyvavhintdqqlsfggstnpaafgt lmsiggiepsrnrdhsaklfdhlntklgipknrmyihfvnlngddvgwngttf
Timeline for d1hfod_: