Lineage for d1hc7d3 (1hc7 D:404-477)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563801Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2564132Superfamily d.68.5: C-terminal domain of ProRS [64586] (1 family) (S)
    contains a metal (zinc)-binding site
  5. 2564133Family d.68.5.1: C-terminal domain of ProRS [64587] (1 protein)
  6. 2564134Protein C-terminal domain of ProRS [64588] (3 species)
  7. 2564145Species Thermus thermophilus [TaxId:274] [64589] (4 PDB entries)
  8. 2564149Domain d1hc7d3: 1hc7 D:404-477 [60949]
    Other proteins in same PDB: d1hc7a1, d1hc7a2, d1hc7b1, d1hc7b2, d1hc7c1, d1hc7c2, d1hc7d1, d1hc7d2
    complexed with zn

Details for d1hc7d3

PDB Entry: 1hc7 (more details), 2.43 Å

PDB Description: prolyl-trna synthetase from thermus thermophilus
PDB Compounds: (D:) prolyl-tRNA synthetase

SCOPe Domain Sequences for d1hc7d3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hc7d3 d.68.5.1 (D:404-477) C-terminal domain of ProRS {Thermus thermophilus [TaxId: 274]}
trkvdtyeafkeavqegfalafhcgdkacerliqeettattrcvpfeaepeegfcvrcgr
psaygkrvvfakay

SCOPe Domain Coordinates for d1hc7d3:

Click to download the PDB-style file with coordinates for d1hc7d3.
(The format of our PDB-style files is described here.)

Timeline for d1hc7d3: