Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) |
Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins) |
Protein Prolyl-tRNA synthetase (ProRS) [64347] (3 species) |
Species Thermus thermophilus [TaxId:274] [64348] (4 PDB entries) |
Domain d1hc7d2: 1hc7 D:5-276 [60948] Other proteins in same PDB: d1hc7a1, d1hc7a3, d1hc7b1, d1hc7b3, d1hc7c1, d1hc7c3, d1hc7d1, d1hc7d3 complexed with zn |
PDB Entry: 1hc7 (more details), 2.43 Å
SCOPe Domain Sequences for d1hc7d2:
Sequence, based on SEQRES records: (download)
>d1hc7d2 d.104.1.1 (D:5-276) Prolyl-tRNA synthetase (ProRS) {Thermus thermophilus [TaxId: 274]} kgltpqsqdfsewyleviqkaeladygpvrgtivvrpygyaiweniqqvldrmfketghq nayfplfipmsflrkeaehvegfspelavvthaggeeleeplavrptsetvigymwskwi rswrdlpqllnqwgnvvrwemrtrpflrtseflwqeghtahatreeaeeevrrmlsiyar lareyaaipvieglktekekfagavytttiealmkdgkalqagtshylgenfarafdikf qdrdlqvkyvhttswglswrfigaiimthgdd
>d1hc7d2 d.104.1.1 (D:5-276) Prolyl-tRNA synthetase (ProRS) {Thermus thermophilus [TaxId: 274]} kgltpqsqdfsewyleviqkaeladygpvrgtivvrpygyaiweniqqvldrmfketghq nayfplfipmsflfspelavvthaggeeleeplavrptsetvigymwskwirswrdlpql lnqwgnvvrwemrtrpflrtseflwqeghtahatreeaeeevrrmlsiyarlareyaaip vieglktekekfagavytttiealmkdgkalqagtshylgenfarafdikfqdrdlqvky vhttswglswrfigaiimthgdd
Timeline for d1hc7d2: