Lineage for d1hc7c2 (1hc7 C:5-276)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208545Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2208546Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2208547Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 2208700Protein Prolyl-tRNA synthetase (ProRS) [64347] (3 species)
  7. 2208711Species Thermus thermophilus [TaxId:274] [64348] (4 PDB entries)
  8. 2208714Domain d1hc7c2: 1hc7 C:5-276 [60945]
    Other proteins in same PDB: d1hc7a1, d1hc7a3, d1hc7b1, d1hc7b3, d1hc7c1, d1hc7c3, d1hc7d1, d1hc7d3
    complexed with zn

Details for d1hc7c2

PDB Entry: 1hc7 (more details), 2.43 Å

PDB Description: prolyl-trna synthetase from thermus thermophilus
PDB Compounds: (C:) prolyl-tRNA synthetase

SCOPe Domain Sequences for d1hc7c2:

Sequence, based on SEQRES records: (download)

>d1hc7c2 d.104.1.1 (C:5-276) Prolyl-tRNA synthetase (ProRS) {Thermus thermophilus [TaxId: 274]}
kgltpqsqdfsewyleviqkaeladygpvrgtivvrpygyaiweniqqvldrmfketghq
nayfplfipmsflrkeaehvegfspelavvthaggeeleeplavrptsetvigymwskwi
rswrdlpqllnqwgnvvrwemrtrpflrtseflwqeghtahatreeaeeevrrmlsiyar
lareyaaipvieglktekekfagavytttiealmkdgkalqagtshylgenfarafdikf
qdrdlqvkyvhttswglswrfigaiimthgdd

Sequence, based on observed residues (ATOM records): (download)

>d1hc7c2 d.104.1.1 (C:5-276) Prolyl-tRNA synthetase (ProRS) {Thermus thermophilus [TaxId: 274]}
kgltpqsqdfsewyleviqkaeladygpvrgtivvrpygyaiweniqqvldrmfketghq
nayfplfipmsflfspelavvthaggeeleeplavrptsetvigymwskwirswrdlpql
lnqwgnvvrwemrtrpflrtseflwqeghtahatreeaeeevrrmlsiyarlareyaaip
vieglktekekfagavytttiealmkdgkalqagtshylgenfarafdikfqdrdlqvky
vhttswglswrfigaiimthgdd

SCOPe Domain Coordinates for d1hc7c2:

Click to download the PDB-style file with coordinates for d1hc7c2.
(The format of our PDB-style files is described here.)

Timeline for d1hc7c2: