SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1hc7b1 (1hc7 B:277-403)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2120781Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2120782Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) (S)
  5. 2120783Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 protein domains)
  6. 2120829Protein Prolyl-tRNA synthetase (ProRS) domain [64071] (3 species)
  7. 2120840Species Thermus thermophilus [TaxId:274] [64072] (4 PDB entries)
  8. 2120842Domain d1hc7b1: 1hc7 B:277-403 [60941]
    Other proteins in same PDB: d1hc7a2, d1hc7a3, d1hc7b2, d1hc7b3, d1hc7c2, d1hc7c3, d1hc7d2, d1hc7d3
    complexed with zn

Details for d1hc7b1

PDB Entry: 1hc7 (more details), 2.43 Å

PDB Description: prolyl-trna synthetase from thermus thermophilus
PDB Compounds: (B:) prolyl-tRNA synthetase

SCOPe Domain Sequences for d1hc7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hc7b1 c.51.1.1 (B:277-403) Prolyl-tRNA synthetase (ProRS) domain {Thermus thermophilus [TaxId: 274]}
rglvlpprlapiqvvivpiykdesrervleaaqglrqallaqglrvhlddrdqhtpgykf
hewelkgvpfrvelgpkdleggqavlasrlggketlplaalpealpgkldafheelyrra
lafredh

SCOPe Domain Coordinates for d1hc7b1:

Click to download the PDB-style file with coordinates for d1hc7b1.
(The format of our PDB-style files is described here.)

Timeline for d1hc7b1: