Lineage for d1hc7a1 (1hc7 A:277-403)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 487574Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 487575Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family) (S)
  5. 487576Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)
  6. 487615Protein Prolyl-tRNA synthetase (ProRS) domain [64071] (3 species)
  7. 487626Species Thermus thermophilus [TaxId:274] [64072] (4 PDB entries)
  8. 487627Domain d1hc7a1: 1hc7 A:277-403 [60938]
    Other proteins in same PDB: d1hc7a2, d1hc7a3, d1hc7b2, d1hc7b3, d1hc7c2, d1hc7c3, d1hc7d2, d1hc7d3

Details for d1hc7a1

PDB Entry: 1hc7 (more details), 2.43 Å

PDB Description: prolyl-trna synthetase from thermus thermophilus

SCOP Domain Sequences for d1hc7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hc7a1 c.51.1.1 (A:277-403) Prolyl-tRNA synthetase (ProRS) domain {Thermus thermophilus}
rglvlpprlapiqvvivpiykdesrervleaaqglrqallaqglrvhlddrdqhtpgykf
hewelkgvpfrvelgpkdleggqavlasrlggketlplaalpealpgkldafheelyrra
lafredh

SCOP Domain Coordinates for d1hc7a1:

Click to download the PDB-style file with coordinates for d1hc7a1.
(The format of our PDB-style files is described here.)

Timeline for d1hc7a1: