| Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
| Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family) ![]() |
| Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins) |
| Protein Prolyl-tRNA synthetase (ProRS) domain [64071] (3 species) |
| Species Thermus thermophilus [TaxId:274] [64072] (4 PDB entries) |
| Domain d1hc7a1: 1hc7 A:277-403 [60938] Other proteins in same PDB: d1hc7a2, d1hc7a3, d1hc7b2, d1hc7b3, d1hc7c2, d1hc7c3, d1hc7d2, d1hc7d3 |
PDB Entry: 1hc7 (more details), 2.43 Å
SCOP Domain Sequences for d1hc7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hc7a1 c.51.1.1 (A:277-403) Prolyl-tRNA synthetase (ProRS) domain {Thermus thermophilus}
rglvlpprlapiqvvivpiykdesrervleaaqglrqallaqglrvhlddrdqhtpgykf
hewelkgvpfrvelgpkdleggqavlasrlggketlplaalpealpgkldafheelyrra
lafredh
Timeline for d1hc7a1: