|  | Class c: Alpha and beta proteins (a/b) [51349] (107 folds) | 
|  | Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies) | 
|  | Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family)  | 
|  | Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins) | 
|  | Protein C-terminal domain of ProRS [64071] (1 species) | 
|  | Species Thermus thermophilus [TaxId:274] [64072] (4 PDB entries) | 
|  | Domain d1hc7a1: 1hc7 A:277-403 [60938] Other proteins in same PDB: d1hc7a2, d1hc7a3, d1hc7b2, d1hc7b3, d1hc7c2, d1hc7c3, d1hc7d2, d1hc7d3 | 
PDB Entry: 1hc7 (more details), 2.43 Å
SCOP Domain Sequences for d1hc7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hc7a1 c.51.1.1 (A:277-403) C-terminal domain of ProRS {Thermus thermophilus}
rglvlpprlapiqvvivpiykdesrervleaaqglrqallaqglrvhlddrdqhtpgykf
hewelkgvpfrvelgpkdleggqavlasrlggketlplaalpealpgkldafheelyrra
lafredh
Timeline for d1hc7a1: