SCOP 1.65: Domain d1hc7a1: 1hc7 A:277-403

Lineage for d1hc7a1 (1hc7 A:277-403)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family)

5. Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins)

6. Protein Prolyl-tRNA synthetase (ProRS) domain [64071] (3 species)

7. Species Thermus thermophilus [TaxId:274] [64072] (4 PDB entries)

8. Domain d1hc7a1: 1hc7 A:277-403 [60938]
   Other proteins in same PDB: d1hc7a2, d1hc7a3, d1hc7b2, d1hc7b3, d1hc7c2, d1hc7c3, d1hc7d2, d1hc7d3

Details for d1hc7a1

PDB Entry: 1hc7, 2.43 Å

PDB Description: prolyl-trna synthetase from thermus thermophilus

SCOP Domain Sequences for d1hc7a1:

Sequence; same for both SEQRES and ATOM records:

>d1hc7a1 c.51.1.1 (A:277-403) Prolyl-tRNA synthetase (ProRS) domain {Thermus thermophilus}
rglvlpprlapiqvvivpiykdesrervleaaqglrqallaqglrvhlddrdqhtpgykf
hewelkgvpfrvelgpkdleggqavlasrlggketlplaalpealpgkldafheelyrra
lafredh

Timeline for d1hc7a1:

• d1hc7a1 first appeared in SCOP 1.57
  
• d1hc7a1 appears in SCOP 1.63
  
• d1hc7a1 appears in SCOP 1.67
  
• d1hc7a1 appears in the current release, SCOPe 2.08