| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.21: ets domain [46859] (9 proteins) |
| Protein Serum response factor accessory protein 1a, SAP-1 [46869] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [46870] (4 PDB entries) |
| Domain d1hbxh_: 1hbx H: [60935] Other proteins in same PDB: d1hbxa_, d1hbxb_, d1hbxd_, d1hbxe_ protein/DNA complex |
PDB Entry: 1hbx (more details), 3.15 Å
SCOPe Domain Sequences for d1hbxh_:
Sequence, based on SEQRES records: (download)
>d1hbxh_ a.4.5.21 (H:) Serum response factor accessory protein 1a, SAP-1 {Human (Homo sapiens) [TaxId: 9606]}
saitlwqfllqllqkpqnkhmicwtsndgqfkllqaeevarlwgirknkpnmnydklsra
lryyyvkniikkvngqkfvykfvsypeilnmdpmtvgriegdceslnfsevsssskdven
ggkdkppqpgaktssrndyihsglyssftlns
>d1hbxh_ a.4.5.21 (H:) Serum response factor accessory protein 1a, SAP-1 {Human (Homo sapiens) [TaxId: 9606]}
saitlwqfllqllqkpqnkhmicwtsndgqfkllqaeevarlwgirknkpnmnydklsra
lryyyvkniikkvngqkfvykfvsypeilnmsrndyihsglyssftlns
Timeline for d1hbxh_: