SCOP 1.63: Domain d1hbxh_: 1hbx H:

Lineage for d1hbxh_ (1hbx H:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (36 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.21: ets domain [46859] (6 proteins)

6. Protein Serum responce factor accessory protein 1a, SAP-1 [46869] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46870] (4 PDB entries)

8. Domain d1hbxh_: 1hbx H: [60935]
   Other proteins in same PDB: d1hbxa_, d1hbxb_, d1hbxd_, d1hbxe_

Details for d1hbxh_

PDB Entry: 1hbx, 3.15 Å

PDB Description: ternary complex of sap-1 and srf with specific sre dna

SCOP Domain Sequences for d1hbxh_:

Sequence, based on SEQRES records:

>d1hbxh_ a.4.5.21 (H:) Serum responce factor accessory protein 1a, SAP-1 {Human (Homo sapiens)}
saitlwqfllqllqkpqnkhmicwtsndgqfkllqaeevarlwgirknkpnmnydklsra
lryyyvkniikkvngqkfvykfvsypeilnmdpmtvgriegdceslnfsevsssskdven
ggkdkppqpgaktssrndyihsglyssftlns

Sequence, based on observed residues (ATOM records):

>d1hbxh_ a.4.5.21 (H:) Serum responce factor accessory protein 1a, SAP-1 {Human (Homo sapiens)}
saitlwqfllqllqkpqnkhmicwtsndgqfkllqaeevarlwgirknkpnmnydklsra
lryyyvkniikkvngqkfvykfvsypeilnmsrndyihsglyssftlns

Timeline for d1hbxh_:

• d1hbxh_ first appeared in SCOP 1.57
  
• d1hbxh_ appears in SCOP 1.61
  
• d1hbxh_ appears in SCOP 1.65
  
• d1hbxh_ appears in the current release, SCOPe 2.08