SCOPe 2.05: Domain d1hbxe_: 1hbx E:

Lineage for d1hbxe_ (1hbx E:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.88: SRF-like [55454] (1 superfamily)
   alpha-beta(2)-alpha; dimer; 3 layers a/b/a; antiparallel beta-sheet

4. Superfamily d.88.1: SRF-like [55455] (1 family)

5. Family d.88.1.1: SRF-like [55456] (5 proteins)

6. Protein Serum response factor (SRF) core [55457] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55458] (3 PDB entries)

8. Domain d1hbxe_: 1hbx E: [60933]
   Other proteins in same PDB: d1hbxg_, d1hbxh_
   protein/DNA complex

Details for d1hbxe_

PDB Entry: 1hbx, 3.15 Å

PDB Description: ternary complex of sap-1 and srf with specific sre dna

PDB Compounds: (E:) serum response factor

SCOPe Domain Sequences for d1hbxe_:

Sequence; same for both SEQRES and ATOM records:

>d1hbxe_ d.88.1.1 (E:) Serum response factor (SRF) core {Human (Homo sapiens) [TaxId: 9606]}
kpgkktrgrvkikmefidnklrryttfskrktgimkkayelstltgtqvlllvasetghv
ytfatrklqpmitsetgkaliqtclnspd

Timeline for d1hbxe_:

• d1hbxe_ first appeared in SCOP 1.57
  
• d1hbxe_ appears in SCOPe 2.04
  
• d1hbxe_ appears in SCOPe 2.06
  
• d1hbxe_ appears in the current release, SCOPe 2.08