Lineage for d1hbxb_ (1hbx B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1917040Fold d.88: SRF-like [55454] (1 superfamily)
    alpha-beta(2)-alpha; dimer; 3 layers a/b/a; antiparallel beta-sheet
  4. 1917041Superfamily d.88.1: SRF-like [55455] (1 family) (S)
  5. 1917042Family d.88.1.1: SRF-like [55456] (5 proteins)
  6. 1917063Protein Serum response factor (SRF) core [55457] (1 species)
  7. 1917064Species Human (Homo sapiens) [TaxId:9606] [55458] (3 PDB entries)
  8. 1917070Domain d1hbxb_: 1hbx B: [60931]
    Other proteins in same PDB: d1hbxg_, d1hbxh_
    protein/DNA complex

Details for d1hbxb_

PDB Entry: 1hbx (more details), 3.15 Å

PDB Description: ternary complex of sap-1 and srf with specific sre dna
PDB Compounds: (B:) serum response factor

SCOPe Domain Sequences for d1hbxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbxb_ d.88.1.1 (B:) Serum response factor (SRF) core {Human (Homo sapiens) [TaxId: 9606]}
kktrgrvkikmefidnklrryttfskrktgimkkayelstltgtqvlllvasetghvytf
atrklqpmitsetgkaliqtclnspd

SCOPe Domain Coordinates for d1hbxb_:

Click to download the PDB-style file with coordinates for d1hbxb_.
(The format of our PDB-style files is described here.)

Timeline for d1hbxb_: