SCOP 1.73: Domain d1hbxa_: 1hbx A:

Lineage for d1hbxa_ (1hbx A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.88: SRF-like [55454] (1 superfamily)
   alpha-beta(2)-alpha; dimer; 3 layers a/b/a; antiparallel beta-sheet

4. Superfamily d.88.1: SRF-like [55455] (1 family)

5. Family d.88.1.1: SRF-like [55456] (4 proteins)

6. Protein Serum response factor (SRF) core [55457] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55458] (3 PDB entries)

8. Domain d1hbxa_: 1hbx A: [60930]
   Other proteins in same PDB: d1hbxg_, d1hbxh_

Details for d1hbxa_

PDB Entry: 1hbx, 3.15 Å

PDB Description: ternary complex of sap-1 and srf with specific sre dna

PDB Compounds: (A:) serum response factor

SCOP Domain Sequences for d1hbxa_:

Sequence; same for both SEQRES and ATOM records:

>d1hbxa_ d.88.1.1 (A:) Serum response factor (SRF) core {Human (Homo sapiens) [TaxId: 9606]}
gkktrgrvkikmefidnklrryttfskrktgimkkayelstltgtqvlllvasetghvyt
fatrklqpmitsetgkaliqtclnspd

Timeline for d1hbxa_:

• d1hbxa_ first appeared in SCOP 1.57
  
• d1hbxa_ appears in SCOP 1.71
  
• d1hbxa_ appears in SCOP 1.75
  
• d1hbxa_ appears in the current release, SCOPe 2.08