SCOP 1.59: Domain d1hbud2: 1hbu D:2-269

Lineage for d1hbud2 (1hbu D:2-269)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.58: Ferredoxin-like [54861] (39 superfamilies)

4. Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (2 families)

5. Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (2 proteins)

6. Protein Alpha chain [55095] (3 species)

7. Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [55096] (5 PDB entries)

8. Domain d1hbud2: 1hbu D:2-269 [60924]
   Other proteins in same PDB: d1hbua1, d1hbub1, d1hbub2, d1hbuc_, d1hbud1, d1hbue1, d1hbue2, d1hbuf_

Details for d1hbud2

PDB Entry: 1hbu, 1.9 Å

PDB Description: methyl-coenzyme m reductase in the mcr-red1-silent state in complex with coenzyme m

SCOP Domain Sequences for d1hbud2:

Sequence; same for both SEQRES and ATOM records:

>d1hbud2 d.58.31.2 (D:2-269) Alpha chain {Archaeon Methanobacterium thermoautotrophicum}
adklfinalkkkfeespeekkttfytlggwkqserktefvnagkevaakrgipqynpdig
tplgqrvlmpyqvsttdtyvegddlhfvnnaamqqmwddirrtvivglnhahaviekrlg
kevtpetithyletvnhampgaavvqehmvethpalvadsyvkvftgndeiadeidpafv
idinkqfpedqaetlkaevgdgiwqvvriptivsrtcdgattsrwsamqigmsmisaykq
aageaatgdfayaakhaevihmgtylpv

Timeline for d1hbud2:

• d1hbud2 first appeared in SCOP 1.57
  
• d1hbud2 appears in SCOP 1.61
  
• d1hbud2 appears in the current release, SCOPe 2.08