Lineage for d1hbuc_ (1hbu C:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1654623Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 1654624Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (1 protein)
    automatically mapped to Pfam PF02240
  6. 1654625Protein Methyl-coenzyme M reductase gamma chain [55090] (3 species)
  7. 1654626Species Methanobacterium thermoautotrophicum [TaxId:145262] [55091] (12 PDB entries)
  8. 1654647Domain d1hbuc_: 1hbu C: [60922]
    Other proteins in same PDB: d1hbua1, d1hbua2, d1hbub1, d1hbub2, d1hbud1, d1hbud2, d1hbue1, d1hbue2
    complexed with cl, com, f43, gol, mg, na, tp7, zn

Details for d1hbuc_

PDB Entry: 1hbu (more details), 1.9 Å

PDB Description: methyl-coenzyme m reductase in the mcr-red1-silent state in complex with coenzyme m
PDB Compounds: (C:) methyl-coenzyme m reductase I gamma subunit

SCOPe Domain Sequences for d1hbuc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbuc_ d.58.31.1 (C:) Methyl-coenzyme M reductase gamma chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
aqyypgttkvaqnrrnfcnpeyeleklreisdedvvkilghrapgeeypsvhppleemde
pedairemvepidgakagdrvryiqftdsmyfapaqpyvrsraylcryrgadagtlsgrq
iietrerdlekiskelleteffdparsgvrgksvhghslrldedgmmfdmlrrqiynkdt
grvemvknqigdeldepvdlgepldeetlmekttiyrvdgeayrddveaveimqrihvlr
sqggfnl

SCOPe Domain Coordinates for d1hbuc_:

Click to download the PDB-style file with coordinates for d1hbuc_.
(The format of our PDB-style files is described here.)

Timeline for d1hbuc_: