Lineage for d1hbuc_ (1hbu C:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191935Fold d.58: Ferredoxin-like [54861] (40 superfamilies)
  4. 192859Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (2 families) (S)
  5. 192860Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (1 protein)
  6. 192861Protein Methyl-coenzyme M reductase gamma chain [55090] (3 species)
  7. 192862Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [55091] (5 PDB entries)
  8. 192871Domain d1hbuc_: 1hbu C: [60922]
    Other proteins in same PDB: d1hbua1, d1hbua2, d1hbub1, d1hbub2, d1hbud1, d1hbud2, d1hbue1, d1hbue2

Details for d1hbuc_

PDB Entry: 1hbu (more details), 1.9 Å

PDB Description: methyl-coenzyme m reductase in the mcr-red1-silent state in complex with coenzyme m

SCOP Domain Sequences for d1hbuc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbuc_ d.58.31.1 (C:) Methyl-coenzyme M reductase gamma chain {Archaeon Methanobacterium thermoautotrophicum}
aqyypgttkvaqnrrnfcnpeyeleklreisdedvvkilghrapgeeypsvhppleemde
pedairemvepidgakagdrvryiqftdsmyfapaqpyvrsraylcryrgadagtlsgrq
iietrerdlekiskelleteffdparsgvrgksvhghslrldedgmmfdmlrrqiynkdt
grvemvknqigdeldepvdlgepldeetlmekttiyrvdgeayrddveaveimqrihvlr
sqggfnl

SCOP Domain Coordinates for d1hbuc_:

Click to download the PDB-style file with coordinates for d1hbuc_.
(The format of our PDB-style files is described here.)

Timeline for d1hbuc_: