Lineage for d1hbod2 (1hbo D:2-269)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1654623Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 1654657Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (2 proteins)
    C-terminal domain is all-alpha
  6. 1654658Protein Alpha chain [55095] (3 species)
  7. 1654659Species Methanobacterium thermoautotrophicum [TaxId:145262] [55096] (11 PDB entries)
  8. 1654677Domain d1hbod2: 1hbo D:2-269 [60914]
    Other proteins in same PDB: d1hboa1, d1hbob1, d1hbob2, d1hboc_, d1hbod1, d1hboe1, d1hboe2, d1hbof_
    complexed with cl, com, f43, gol, mg, na, tp7, zn

Details for d1hbod2

PDB Entry: 1hbo (more details), 1.78 Å

PDB Description: methyl-coenzyme m reductase mcr-red1-silent
PDB Compounds: (D:) methyl-coenzyme m reductase I alpha subunit

SCOPe Domain Sequences for d1hbod2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbod2 d.58.31.2 (D:2-269) Alpha chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
adklfinalkkkfeespeekkttfytlggwkqserktefvnagkevaakrgipqynpdig
tplgqrvlmpyqvsttdtyvegddlhfvnnaamqqmwddirrtvivglnhahaviekrlg
kevtpetithyletvnhampgaavvqehmvethpalvadsyvkvftgndeiadeidpafv
idinkqfpedqaetlkaevgdgiwqvvriptivsrtcdgattsrwsamqigmsmisaykq
aageaatgdfayaakhaevihmgtylpv

SCOPe Domain Coordinates for d1hbod2:

Click to download the PDB-style file with coordinates for d1hbod2.
(The format of our PDB-style files is described here.)

Timeline for d1hbod2: