Lineage for d1hbod1 (1hbo D:270-549)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 644818Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
    multihelical bundle; contains buried central helix
  4. 644819Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (1 family) (S)
  5. 644820Family a.89.1.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48082] (2 proteins)
    C-terminal domain is all-alpha
  6. 644821Protein Alpha chain [48083] (3 species)
  7. 644822Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [48084] (5 PDB entries)
  8. 644828Domain d1hbod1: 1hbo D:270-549 [60913]
    Other proteins in same PDB: d1hboa2, d1hbob1, d1hbob2, d1hboc_, d1hbod2, d1hboe1, d1hboe2, d1hbof_
    complexed with cl, com, f43, gol, mg, mgn, na, tp7, zn

Details for d1hbod1

PDB Entry: 1hbo (more details), 1.78 Å

PDB Description: methyl-coenzyme m reductase mcr-red1-silent
PDB Compounds: (D:) methyl-coenzyme m reductase I alpha subunit

SCOP Domain Sequences for d1hbod1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbod1 a.89.1.1 (D:270-549) Alpha chain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}
rrargenepggvpfgyladicqssrvnyedpvrvsldvvatgamlydqiwlgsymsggvg
ftqyataaytdnilddftyfgkeyvedkyglceapnnmdtvldvatevtfygleqyeeyp
alledqfggsqraavvaaaagcstafatgnaqtglsgwylsmylhkeqhsrlgfygydlq
dqcgasnvfsirgdeglplelrgpnypnyamnvghqgeyagisqaphaargdafvfnplv
kiafaddnlvfdftnvrgefakgalrefepageralitpa

SCOP Domain Coordinates for d1hbod1:

Click to download the PDB-style file with coordinates for d1hbod1.
(The format of our PDB-style files is described here.)

Timeline for d1hbod1: