SCOPe 2.08: Domain d1hbod1: 1hbo D:270-549

Lineage for d1hbod1 (1hbo D:270-549)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
   multihelical bundle; contains buried central helix

4. Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families)

5. Family a.89.1.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48082] (3 proteins)
   C-terminal domain is all-alpha

6. Protein Alpha chain [48083] (3 species)

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [48084] (11 PDB entries)

8. Domain d1hbod1: 1hbo D:270-549 [60913]
   Other proteins in same PDB: d1hboa2, d1hbob1, d1hbob2, d1hboc_, d1hbod2, d1hboe1, d1hboe2, d1hbof_
   complexed with cl, com, f43, gol, mg, na, tp7, zn

Details for d1hbod1

PDB Entry: 1hbo, 1.78 Å

PDB Description: methyl-coenzyme m reductase mcr-red1-silent

PDB Compounds: (D:) methyl-coenzyme m reductase I alpha subunit

SCOPe Domain Sequences for d1hbod1:

Sequence; same for both SEQRES and ATOM records:

>d1hbod1 a.89.1.1 (D:270-549) Alpha chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
rrargenepggvpfgyladicqssrvnyedpvrvsldvvatgamlydqiwlgsymsggvg
ftqyataaytdnilddftyfgkeyvedkyglceapnnmdtvldvatevtfygleqyeeyp
alledqfggsqraavvaaaagcstafatgnaqtglsgwylsmylhkeqhsrlgfygydlq
dqcgasnvfsirgdeglplelrgpnypnyamnvghqgeyagisqaphaargdafvfnplv
kiafaddnlvfdftnvrgefakgalrefepageralitpa

Timeline for d1hbod1:

• d1hbod1 first appeared in SCOP 1.57
  
• d1hbod1 appears in SCOPe 2.07