Lineage for d1hbob2 (1hbo B:2-188)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1207232Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (2 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 1207266Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (2 proteins)
    C-terminal domain is all-alpha
  6. 1207285Protein Beta chain [55099] (3 species)
  7. 1207286Species Methanobacterium thermoautotrophicum [TaxId:145262] [55100] (5 PDB entries)
  8. 1207293Domain d1hbob2: 1hbo B:2-188 [60911]
    Other proteins in same PDB: d1hboa1, d1hboa2, d1hbob1, d1hboc_, d1hbod1, d1hbod2, d1hboe1, d1hbof_
    complexed with cl, com, f43, gol, mg, na, tp7, zn

Details for d1hbob2

PDB Entry: 1hbo (more details), 1.78 Å

PDB Description: methyl-coenzyme m reductase mcr-red1-silent
PDB Compounds: (B:) methyl-coenzyme m reductase I beta subunit

SCOPe Domain Sequences for d1hbob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbob2 d.58.31.2 (B:2-188) Beta chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
akfedkvdlyddrgnlveeqvplealsplrnpaiksivqgikrtvavnlegienalktak
vggpackimgreldldivgnaesiaaaakemiqvtedddtnvellgggkralvqvpsarf
dvaaeysaaplvtatafvqaiinefdvsmydanmvkaavlgrypqsveymganiatmldi
pqklegp

SCOPe Domain Coordinates for d1hbob2:

Click to download the PDB-style file with coordinates for d1hbob2.
(The format of our PDB-style files is described here.)

Timeline for d1hbob2: