Lineage for d1hbob1 (1hbo B:189-443)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 215786Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
    multihelical bundle; contains buried central helix
  4. 215787Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (1 family) (S)
  5. 215788Family a.89.1.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48082] (2 proteins)
    C-terminal domain is all-alpha
  6. 215807Protein Beta chain [48087] (3 species)
  7. 215808Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [48088] (5 PDB entries)
  8. 215815Domain d1hbob1: 1hbo B:189-443 [60910]
    Other proteins in same PDB: d1hboa1, d1hboa2, d1hbob2, d1hboc_, d1hbod1, d1hbod2, d1hboe2, d1hbof_

Details for d1hbob1

PDB Entry: 1hbo (more details), 1.78 Å

PDB Description: methyl-coenzyme m reductase mcr-red1-silent

SCOP Domain Sequences for d1hbob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbob1 a.89.1.1 (B:189-443) Beta chain {Archaeon Methanobacterium thermoautotrophicum}
gyalrnimvnhvvaatlkntlqaaalstileqtamfemgdavgafermhllglayqgmna
dnlvfdlvkangkegtvgsviadlveraledgvikvekeltdykvygtddlamwnayaaa
glmaatmvnqgaaraaqgvsstllyyndliefetglpsvdfgkvegtavgfsffshsiyg
gggpgifngnhivtrhskgfaipcvaaamaldagtqmfspeatsglikevfsqvdefrep
lkyvveaaaeiknei

SCOP Domain Coordinates for d1hbob1:

Click to download the PDB-style file with coordinates for d1hbob1.
(The format of our PDB-style files is described here.)

Timeline for d1hbob1: