Lineage for d1hbnd1 (1hbn D:270-549)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1741072Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
    multihelical bundle; contains buried central helix
  4. 1741073Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families) (S)
  5. 1741074Family a.89.1.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48082] (2 proteins)
    C-terminal domain is all-alpha
  6. 1741075Protein Alpha chain [48083] (3 species)
  7. 1741076Species Methanobacterium thermoautotrophicum [TaxId:145262] [48084] (11 PDB entries)
  8. 1741078Domain d1hbnd1: 1hbn D:270-549 [60903]
    Other proteins in same PDB: d1hbna2, d1hbnb1, d1hbnb2, d1hbnc_, d1hbnd2, d1hbne1, d1hbne2, d1hbnf_
    complexed with cl, com, f43, gol, mg, na, tp7, zn

Details for d1hbnd1

PDB Entry: 1hbn (more details), 1.16 Å

PDB Description: methyl-coenzyme m reductase
PDB Compounds: (D:) methyl-coenzyme m reductase I alpha subunit

SCOPe Domain Sequences for d1hbnd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbnd1 a.89.1.1 (D:270-549) Alpha chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
rrargenepggvpfgyladicqssrvnyedpvrvsldvvatgamlydqiwlgsymsggvg
ftqyataaytdnilddftyfgkeyvedkyglceapnnmdtvldvatevtfygleqyeeyp
alledqfggsqraavvaaaagcstafatgnaqtglsgwylsmylhkeqhsrlgfygydlq
dqcgasnvfsirgdeglplelrgpnypnyamnvghqgeyagisqaphaargdafvfnplv
kiafaddnlvfdftnvrgefakgalrefepageralitpa

SCOPe Domain Coordinates for d1hbnd1:

Click to download the PDB-style file with coordinates for d1hbnd1.
(The format of our PDB-style files is described here.)

Timeline for d1hbnd1: