Lineage for d1hbnb2 (1hbn B:2-188)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2197885Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 2197936Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (3 proteins)
    C-terminal domain is all-alpha
  6. 2197967Protein Beta chain [55099] (3 species)
  7. 2197968Species Methanobacterium thermoautotrophicum [TaxId:145262] [55100] (11 PDB entries)
  8. 2197969Domain d1hbnb2: 1hbn B:2-188 [60901]
    Other proteins in same PDB: d1hbna1, d1hbna2, d1hbnb1, d1hbnc_, d1hbnd1, d1hbnd2, d1hbne1, d1hbnf_
    complexed with cl, com, f43, gol, mg, na, tp7, zn

Details for d1hbnb2

PDB Entry: 1hbn (more details), 1.16 Å

PDB Description: methyl-coenzyme m reductase
PDB Compounds: (B:) methyl-coenzyme m reductase I beta subunit

SCOPe Domain Sequences for d1hbnb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbnb2 d.58.31.2 (B:2-188) Beta chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
akfedkvdlyddrgnlveeqvplealsplrnpaiksivqgikrtvavnlegienalktak
vggpackimgreldldivgnaesiaaaakemiqvtedddtnvellgggkralvqvpsarf
dvaaeysaaplvtatafvqaiinefdvsmydanmvkaavlgrypqsveymganiatmldi
pqklegp

SCOPe Domain Coordinates for d1hbnb2:

Click to download the PDB-style file with coordinates for d1hbnb2.
(The format of our PDB-style files is described here.)

Timeline for d1hbnb2: