Lineage for d1hbmd1 (1hbm D:270-549)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1496760Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
    multihelical bundle; contains buried central helix
  4. 1496761Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families) (S)
  5. 1496762Family a.89.1.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48082] (2 proteins)
    C-terminal domain is all-alpha
  6. 1496763Protein Alpha chain [48083] (3 species)
  7. 1496764Species Methanobacterium thermoautotrophicum [TaxId:145262] [48084] (11 PDB entries)
  8. 1496780Domain d1hbmd1: 1hbm D:270-549 [60893]
    Other proteins in same PDB: d1hbma2, d1hbmb1, d1hbmb2, d1hbmc_, d1hbmd2, d1hbme1, d1hbme2, d1hbmf_
    complexed with cl, f43, gol, mg, na, sht, zn

Details for d1hbmd1

PDB Entry: 1hbm (more details), 1.8 Å

PDB Description: methyl-coenzyme m reductase enzyme product complex
PDB Compounds: (D:) methyl-coenzyme m reductase I alpha subunit

SCOPe Domain Sequences for d1hbmd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbmd1 a.89.1.1 (D:270-549) Alpha chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
rrargenepggvpfgyladicqssrvnyedpvrvsldvvatgamlydqiwlgsymsggvg
ftqyataaytdnilddftyfgkeyvedkyglceapnnmdtvldvatevtfygleqyeeyp
alledqfggsqraavvaaaagcstafatgnaqtglsgwylsmylhkeqhsrlgfygydlq
dqcgasnvfsirgdeglplelrgpnypnyamnvghqgeyagisqaphaargdafvfnplv
kiafaddnlvfdftnvrgefakgalrefepageralitpa

SCOPe Domain Coordinates for d1hbmd1:

Click to download the PDB-style file with coordinates for d1hbmd1.
(The format of our PDB-style files is described here.)

Timeline for d1hbmd1: