Lineage for d1hbma2 (1hbm A:2-269)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1207232Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (2 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 1207266Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (2 proteins)
    C-terminal domain is all-alpha
  6. 1207267Protein Alpha chain [55095] (3 species)
  7. 1207268Species Methanobacterium thermoautotrophicum [TaxId:145262] [55096] (5 PDB entries)
  8. 1207273Domain d1hbma2: 1hbm A:2-269 [60889]
    Other proteins in same PDB: d1hbma1, d1hbmb1, d1hbmb2, d1hbmc_, d1hbmd1, d1hbme1, d1hbme2, d1hbmf_
    complexed with cl, f43, gol, mg, na, sht, zn

Details for d1hbma2

PDB Entry: 1hbm (more details), 1.8 Å

PDB Description: methyl-coenzyme m reductase enzyme product complex
PDB Compounds: (A:) methyl-coenzyme m reductase I alpha subunit

SCOPe Domain Sequences for d1hbma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbma2 d.58.31.2 (A:2-269) Alpha chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
adklfinalkkkfeespeekkttfytlggwkqserktefvnagkevaakrgipqynpdig
tplgqrvlmpyqvsttdtyvegddlhfvnnaamqqmwddirrtvivglnhahaviekrlg
kevtpetithyletvnhampgaavvqehmvethpalvadsyvkvftgndeiadeidpafv
idinkqfpedqaetlkaevgdgiwqvvriptivsrtcdgattsrwsamqigmsmisaykq
aageaatgdfayaakhaevihmgtylpv

SCOPe Domain Coordinates for d1hbma2:

Click to download the PDB-style file with coordinates for d1hbma2.
(The format of our PDB-style files is described here.)

Timeline for d1hbma2: