SCOP 1.61: Domain d1hawa2: 1haw A:160-336

Lineage for d1hawa2 (1haw A:160-336)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)

4. Superfamily b.6.1: Cupredoxins [49503] (5 families)

5. Family b.6.1.3: Multidomain cupredoxins [49550] (5 proteins)

6. Protein Nitrite reductase, NIR [49551] (4 species)

7. Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (9 PDB entries)

8. Domain d1hawa2: 1haw A:160-336 [60882]

Details for d1hawa2

PDB Entry: 1haw, 1.9 Å

PDB Description: x-ray structure of a blue copper nitrite reductase at high ph and in copper free form at 1.9 a resolution

SCOP Domain Sequences for d1hawa2:

Sequence; same for both SEQRES and ATOM records:

>d1hawa2 b.6.1.3 (A:160-336) Nitrite reductase, NIR {Alcaligenes xylosoxidans}
qgkplhydraytigefdlyipkgpdgkykdyatlaesygdtvqvmrtltpshivfngkvg
altganaltakvgetvllihsqanrdtrphligghgdwvwetgkfanppqrdletwfirg
gsagaalytfkqpgvyaylnhnlieafelgaaghikvegkwnddlmkqikapapipr

Timeline for d1hawa2:

• d1hawa2 first appeared in SCOP 1.57
  
• d1hawa2 appears in SCOP 1.59
  
• d1hawa2 appears in SCOP 1.63
  
• d1hawa2 appears in the current release, SCOPe 2.08