Lineage for d1ha3a1 (1ha3 A:213-312)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1317091Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1317134Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 1317135Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 1317224Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
    N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology
  7. 1317256Species Thermus thermophilus [TaxId:274] [50452] (6 PDB entries)
  8. 1317260Domain d1ha3a1: 1ha3 A:213-312 [60869]
    Other proteins in same PDB: d1ha3a2, d1ha3a3, d1ha3b2, d1ha3b3
    complexed with bme, gdp, mau, mg

Details for d1ha3a1

PDB Entry: 1ha3 (more details), 2 Å

PDB Description: elongation factor tu in complex with aurodox
PDB Compounds: (A:) elongation factor tu

SCOPe Domain Sequences for d1ha3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ha3a1 b.43.3.1 (A:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus thermophilus [TaxId: 274]}
pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktvvtgvem
hrktlqegiagdnvgvllrgvsreevergqvlakpgsitp

SCOPe Domain Coordinates for d1ha3a1:

Click to download the PDB-style file with coordinates for d1ha3a1.
(The format of our PDB-style files is described here.)

Timeline for d1ha3a1: