Lineage for d1ha3a1 (1ha3 A:213-312)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 60076Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 60087Superfamily b.43.3: Translation proteins [50447] (2 families) (S)
  5. 60088Family b.43.3.1: Elongation factors [50448] (4 proteins)
  6. 60102Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
  7. 60126Species Thermus thermophilus [TaxId:274] [50452] (3 PDB entries)
  8. 60128Domain d1ha3a1: 1ha3 A:213-312 [60869]
    Other proteins in same PDB: d1ha3a2, d1ha3a3, d1ha3b2, d1ha3b3

Details for d1ha3a1

PDB Entry: 1ha3 (more details), 2 Å

PDB Description: elongation factor tu in complex with aurodox

SCOP Domain Sequences for d1ha3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ha3a1 b.43.3.1 (A:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus thermophilus}
pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktvvtgvem
hrktlqegiagdnvgvllrgvsreevergqvlakpgsitp

SCOP Domain Coordinates for d1ha3a1:

Click to download the PDB-style file with coordinates for d1ha3a1.
(The format of our PDB-style files is described here.)

Timeline for d1ha3a1: