PDB entry 1ha3

View 1ha3 on RCSB PDB site
Description: elongation factor tu in complex with aurodox
Deposited on 2001-03-26, released 2001-05-15
The last revision prior to the SCOP 1.57 freeze date was dated 2001-05-15, with a file datestamp of 2001-05-15.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.191
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ha3A (A:)
    gefirtkphvnvgtighvdhgkttltaaltfvtaaenpnvevkdygdidkapeerargit
    intahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehill
    arqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleqm
    hrnpktrrgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatgri
    ergkvkvgdeveivglapetrktvvtgvemhrktlqegiagdnvgvllrgvsreevergq
    vlakpgsitphtkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgvemv
    mpgdnvtftvelikpvaleeglrfaireggrtvgagvvtkile
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ha3A (A:)
    gefirtkphvnvgtighvdhgkttltaaltfvtaaenpnvevkdygdidktahveyetak
    rhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehillarqvgvpyivvf
    mnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleqmhrnpktrrgene
    wvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeve
    ivglapetrktvvtgvemhrktlqegiagdnvgvllrgvsreevergqvlakpgsitpht
    kfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgvemvmpgdnvtftvel
    ikpvaleeglrfaireggrtvgagvvtkile
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ha3B (B:)
    gefirtkphvnvgtighvdhgkttltaaltfvtaaenpnvevkdygdidkapeerargit
    intahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehill
    arqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleqm
    hrnpktrrgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatgri
    ergkvkvgdeveivglapetrktvvtgvemhrktlqegiagdnvgvllrgvsreevergq
    vlakpgsitphtkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgvemv
    mpgdnvtftvelikpvaleeglrfaireggrtvgagvvtkile
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ha3B (B:)
    gefirtkphvnvgtighvdhgkttltaaltfvtaaenpnahveyetakrhyshvdcpgha
    dyiknmitgaaqmdgailvvsaadgpmpqtrehillarqvgvpyivvfmnkvdmvddpel
    ldlvemevrdllnqyefpgdevpvirgsallaleqmhrnpktrrgenewvdkiwelldai
    deyiptpvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktv
    vtgvemhrktlqegiagdnvgvllrgvsreevergqvlakpgsitphtkfeasvyvlkke
    eggrhtgffsgyrpqfyfrttdvtgvvqlppgvemvmpgdnvtftvelikpvaleeglrf
    aireggrtvgagvvtkile