Lineage for d1h9sb2 (1h9s B:200-260)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1542493Superfamily b.40.6: MOP-like [50331] (4 families) (S)
  5. 1542540Family b.40.6.2: BiMOP, duplicated molybdate-binding domain [50335] (2 proteins)
    duplication: tandem repeat of two OB-fold domains with swapped C-terminal strands
    automatically mapped to Pfam PF03459
  6. 1542541Protein C-terminal domain of molybdate-dependent transcriptional regulator ModE [63405] (1 species)
  7. 1542542Species Escherichia coli [TaxId:562] [50337] (5 PDB entries)
  8. 1542546Domain d1h9sb2: 1h9s B:200-260 [60846]
    complexed with moo

Details for d1h9sb2

PDB Entry: 1h9s (more details), 1.82 Å

PDB Description: molybdate bound complex of dimop domain of mode from e.coli
PDB Compounds: (B:) molybdenum transport protein mode

SCOPe Domain Sequences for d1h9sb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h9sb2 b.40.6.2 (B:200-260) C-terminal domain of molybdate-dependent transcriptional regulator ModE {Escherichia coli [TaxId: 562]}
dnqlpgiishiergaeqcevlmalpdgqtlcatvpvneatsleqgqnvtayfnadsviia
t

SCOPe Domain Coordinates for d1h9sb2:

Click to download the PDB-style file with coordinates for d1h9sb2.
(The format of our PDB-style files is described here.)

Timeline for d1h9sb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h9sb1