SCOPe 2.02: Domain d1h9sa2: 1h9s A:200-260

Lineage for d1h9sa2 (1h9s A:200-260)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.6: MOP-like [50331] (3 families)

5. Family b.40.6.2: BiMOP, duplicated molybdate-binding domain [50335] (2 proteins)
   duplication: tandem repeat of two OB-fold domains with swapped C-terminal strands

6. Protein C-terminal domain of molybdate-dependent transcriptional regulator ModE [63405] (1 species)

7. Species Escherichia coli [TaxId:562] [50337] (5 PDB entries)

8. Domain d1h9sa2: 1h9s A:200-260 [60844]
   complexed with moo

Details for d1h9sa2

PDB Entry: 1h9s, 1.82 Å

PDB Description: molybdate bound complex of dimop domain of mode from e.coli

PDB Compounds: (A:) molybdenum transport protein mode

SCOPe Domain Sequences for d1h9sa2:

Sequence; same for both SEQRES and ATOM records:

>d1h9sa2 b.40.6.2 (A:200-260) C-terminal domain of molybdate-dependent transcriptional regulator ModE {Escherichia coli [TaxId: 562]}
dnqlpgiishiergaeqcevlmalpdgqtlcatvpvneatslqqgqnvtayfnadsviia
t

Timeline for d1h9sa2:

• d1h9sa2 first appeared in SCOP 1.57
  
• d1h9sa2 appears in SCOPe 2.01
  
• d1h9sa2 appears in SCOPe 2.03
  
• d1h9sa2 appears in the current release, SCOPe 2.08