Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.6: MOP-like [50331] (3 families) |
Family b.40.6.2: BiMOP, duplicated molybdate-binding domain [50335] (2 proteins) duplication: tandem repeat of two OB-fold domains with swapped C-terminal strands |
Protein C-terminal domain of molybdate-dependent transcriptional regulator ModE [63405] (1 species) |
Species Escherichia coli [TaxId:562] [50337] (5 PDB entries) |
Domain d1h9sa2: 1h9s A:200-260 [60844] complexed with moo |
PDB Entry: 1h9s (more details), 1.82 Å
SCOPe Domain Sequences for d1h9sa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h9sa2 b.40.6.2 (A:200-260) C-terminal domain of molybdate-dependent transcriptional regulator ModE {Escherichia coli [TaxId: 562]} dnqlpgiishiergaeqcevlmalpdgqtlcatvpvneatslqqgqnvtayfnadsviia t
Timeline for d1h9sa2: