Lineage for d1h9ra2 (1h9r A:200-261)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123681Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1125780Superfamily b.40.6: MOP-like [50331] (3 families) (S)
  5. 1125827Family b.40.6.2: BiMOP, duplicated molybdate-binding domain [50335] (2 proteins)
    duplication: tandem repeat of two OB-fold domains with swapped C-terminal strands
  6. 1125828Protein C-terminal domain of molybdate-dependent transcriptional regulator ModE [63405] (1 species)
  7. 1125829Species Escherichia coli [TaxId:562] [50337] (5 PDB entries)
  8. 1125835Domain d1h9ra2: 1h9r A:200-261 [60840]
    complexed with ni, wo4

Details for d1h9ra2

PDB Entry: 1h9r (more details), 1.9 Å

PDB Description: tungstate bound complex dimop domain of mode from e.coli
PDB Compounds: (A:) molybdenum transport protein mode

SCOPe Domain Sequences for d1h9ra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h9ra2 b.40.6.2 (A:200-261) C-terminal domain of molybdate-dependent transcriptional regulator ModE {Escherichia coli [TaxId: 562]}
dnqlpgiishiergaeqcevlmalpdgqtlcatvpvneatslqqgqnvtayfnadsviia
tl

SCOPe Domain Coordinates for d1h9ra2:

Click to download the PDB-style file with coordinates for d1h9ra2.
(The format of our PDB-style files is described here.)

Timeline for d1h9ra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h9ra1