SCOPe 2.02: Domain d1h9mb2: 1h9m B:74-141

Lineage for d1h9mb2 (1h9m B:74-141)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.6: MOP-like [50331] (3 families)

5. Family b.40.6.2: BiMOP, duplicated molybdate-binding domain [50335] (2 proteins)
   duplication: tandem repeat of two OB-fold domains with swapped C-terminal strands

6. Protein Cytoplasmic molybdate-binding protein ModG [63776] (1 species)

7. Species Azotobacter vinelandii [TaxId:354] [63777] (3 PDB entries)

8. Domain d1h9mb2: 1h9m B:74-141 [60836]
   complexed with moo

Details for d1h9mb2

PDB Entry: 1h9m, 1.65 Å

PDB Description: two crystal structures of the cytoplasmic molybdate-binding protein modg suggest a novel cooperative binding mechanism and provide insights into ligand-binding specificity. peg-grown form with molybdate bound

PDB Compounds: (B:) molybdenum-binding-protein

SCOPe Domain Sequences for d1h9mb2:

Sequence; same for both SEQRES and ATOM records:

>d1h9mb2 b.40.6.2 (B:74-141) Cytoplasmic molybdate-binding protein ModG {Azotobacter vinelandii [TaxId: 354]}
rlsarniltgtvktietgavnaevtlalqggteitsmvtkeavaelglkpgasasavika
snvilgvp

Timeline for d1h9mb2:

• d1h9mb2 first appeared in SCOP 1.57
  
• d1h9mb2 appears in SCOPe 2.01
  
• d1h9mb2 appears in SCOPe 2.03
  
• d1h9mb2 appears in the current release, SCOPe 2.08