SCOP 1.69: Domain d1h9ga2: 1h9g A:79-227

Lineage for d1h9ga2 (1h9g A:79-227)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.78: Fatty acid responsive transcription factor FadR, C-terminal domain [48007] (1 superfamily)
   core: 6 helices: closed bundle; greek-key; internal pseudo twofold symmetry

4. Superfamily a.78.1: Fatty acid responsive transcription factor FadR, C-terminal domain [48008] (1 family)

5. Family a.78.1.1: Fatty acid responsive transcription factor FadR, C-terminal domain [48009] (1 protein)

6. Protein Fatty acid responsive transcription factor FadR, C-terminal domain [48010] (1 species)

7. Species Escherichia coli [TaxId:562] [48011] (5 PDB entries)

8. Domain d1h9ga2: 1h9g A:79-227 [60828]
   Other proteins in same PDB: d1h9ga1
   complex with myristoyl-CoA

Details for d1h9ga2

PDB Entry: 1h9g, 2.1 Å

PDB Description: fadr, fatty acid responsive transcription factor from e. coli, in complex with myristoyl-coa

SCOP Domain Sequences for d1h9ga2:

Sequence; same for both SEQRES and ATOM records:

>d1h9ga2 a.78.1.1 (A:79-227) Fatty acid responsive transcription factor FadR, C-terminal domain {Escherichia coli}
glniletlarldhesvpqlidnllsvrtnistifirtafrqhpdkaqevlatanevadha
dafaeldynifrglafasgnpiyglilngmkglytrigrhyfanpearslalgfyhklsa
lcsegahdqvyetvrryghesgeiwhrmq

Timeline for d1h9ga2:

• d1h9ga2 first appeared in SCOP 1.57
  
• d1h9ga2 appears in SCOP 1.67
  
• d1h9ga2 appears in SCOP 1.71
  
• d1h9ga2 appears in the current release, SCOPe 2.08