Lineage for d1h9ga2 (1h9g A:79-227)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2001708Fold a.78: GntR ligand-binding domain-like [48007] (1 superfamily)
    core: 6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 2001709Superfamily a.78.1: GntR ligand-binding domain-like [48008] (1 family) (S)
  5. 2001710Family a.78.1.1: GntR ligand-binding domain-like [48009] (2 protein domains)
  6. 2001711Protein Fatty acid responsive transcription factor FadR, C-terminal domain [48010] (1 species)
  7. 2001712Species Escherichia coli [TaxId:562] [48011] (5 PDB entries)
  8. 2001716Domain d1h9ga2: 1h9g A:79-227 [60828]
    Other proteins in same PDB: d1h9ga1
    complex with myristoyl-CoA
    complexed with coa, myr

Details for d1h9ga2

PDB Entry: 1h9g (more details), 2.1 Å

PDB Description: fadr, fatty acid responsive transcription factor from e. coli, in complex with myristoyl-coa
PDB Compounds: (A:) fatty acid metabolism regulator protein

SCOPe Domain Sequences for d1h9ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h9ga2 a.78.1.1 (A:79-227) Fatty acid responsive transcription factor FadR, C-terminal domain {Escherichia coli [TaxId: 562]}
glniletlarldhesvpqlidnllsvrtnistifirtafrqhpdkaqevlatanevadha
dafaeldynifrglafasgnpiyglilngmkglytrigrhyfanpearslalgfyhklsa
lcsegahdqvyetvrryghesgeiwhrmq

SCOPe Domain Coordinates for d1h9ga2:

Click to download the PDB-style file with coordinates for d1h9ga2.
(The format of our PDB-style files is described here.)

Timeline for d1h9ga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h9ga1