SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1h9ga2 (1h9g A:79-227)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2001708Fold a.78: GntR ligand-binding domain-like [48007] (1 superfamily)
    core: 6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 2001709Superfamily a.78.1: GntR ligand-binding domain-like [48008] (1 family) (S)
  5. 2001710Family a.78.1.1: GntR ligand-binding domain-like [48009] (2 protein domains)
  6. 2001711Protein Fatty acid responsive transcription factor FadR, C-terminal domain [48010] (1 species)
  7. 2001712Species Escherichia coli [TaxId:562] [48011] (5 PDB entries)
  8. 2001716Domain d1h9ga2: 1h9g A:79-227 [60828]
    Other proteins in same PDB: d1h9ga1
    complex with myristoyl-CoA
    complexed with coa, myr

Details for d1h9ga2

PDB Entry: 1h9g (more details), 2.1 Å

PDB Description: fadr, fatty acid responsive transcription factor from e. coli, in complex with myristoyl-coa
PDB Compounds: (A:) fatty acid metabolism regulator protein

SCOPe Domain Sequences for d1h9ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h9ga2 a.78.1.1 (A:79-227) Fatty acid responsive transcription factor FadR, C-terminal domain {Escherichia coli [TaxId: 562]}
glniletlarldhesvpqlidnllsvrtnistifirtafrqhpdkaqevlatanevadha
dafaeldynifrglafasgnpiyglilngmkglytrigrhyfanpearslalgfyhklsa
lcsegahdqvyetvrryghesgeiwhrmq

SCOPe Domain Coordinates for d1h9ga2:

Click to download the PDB-style file with coordinates for d1h9ga2.
(The format of our PDB-style files is described here.)

Timeline for d1h9ga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h9ga1