Lineage for d1h9da_ (1h9d A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 552572Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 552786Superfamily b.2.5: p53-like transcription factors [49417] (7 families) (S)
  5. 552894Family b.2.5.6: RUNT domain [81318] (1 protein)
  6. 552895Protein Acute myeloid leukemia 1 protein (AML1), RUNT domain [49439] (2 species)
    synonym: core binding factor alpha, cbfa
  7. 552896Species Human (Homo sapiens) [TaxId:9606] [49440] (5 PDB entries)
  8. 552899Domain d1h9da_: 1h9d A: [60821]
    Other proteins in same PDB: d1h9db_, d1h9dd_

Details for d1h9da_

PDB Entry: 1h9d (more details), 2.6 Å

PDB Description: aml1/cbf-beta/dna complex

SCOP Domain Sequences for d1h9da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h9da_ b.2.5.6 (A:) Acute myeloid leukemia 1 protein (AML1), RUNT domain {Human (Homo sapiens)}
vladhpgelvrtdspnflcsvlpthwrcnktlpiafkvvalgdvpdgtlvtvmagndeny
saelrnataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitvdgp
reprr

SCOP Domain Coordinates for d1h9da_:

Click to download the PDB-style file with coordinates for d1h9da_.
(The format of our PDB-style files is described here.)

Timeline for d1h9da_: