Class b: All beta proteins [48724] (180 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.5: p53-like transcription factors [49417] (8 families) |
Family b.2.5.6: RUNT domain [81318] (2 proteins) automatically mapped to Pfam PF00853 |
Protein Acute myeloid leukemia 1 protein (AML1), RUNT domain [49439] (2 species) synonym: core binding factor alpha, cbfa |
Species Human (Homo sapiens) [TaxId:9606] [49440] (5 PDB entries) |
Domain d1h9da_: 1h9d A: [60821] Other proteins in same PDB: d1h9db_, d1h9dd_ |
PDB Entry: 1h9d (more details), 2.6 Å
SCOPe Domain Sequences for d1h9da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h9da_ b.2.5.6 (A:) Acute myeloid leukemia 1 protein (AML1), RUNT domain {Human (Homo sapiens) [TaxId: 9606]} vladhpgelvrtdspnflcsvlpthwrcnktlpiafkvvalgdvpdgtlvtvmagndeny saelrnataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitvdgp reprr
Timeline for d1h9da_: